I'm working on an apache module that converts groups of slashes into single slashes in order to avoid duplicate content on a website. The problem I have is that the strcat functions don't seem to be doing anything. I'm trying to use them to prepend "http://example.com" to the resulting URL for a user to redirect to if it initially contained groups of 2 or more slashes stuck together.
static int handler(request_rec *r){
if (strcmp(r->handler,"httpd/unix-directory")==0){return DECLINED;}
unsigned long flag=0,ct=0;
char xi[100004],*xuri=xi,*up=r->unparsed_uri;
*xuri='\0';
strcat(xuri,"http://");
strcat(xuri,r->hostname);
while (*up != '\0'){
if (*up=='/'){flag++;}else{flag=0;}
if (flag < 2){*xuri=*up;xuri++;ct++;if (ct >= 100000){break;}}
if (flag > 1){flag=2;}
up++;
}
if (ct < 100000){
if (ct > 0){xuri--;}
if (*xuri=='/'){*xuri='\0';}
xuri++;*xuri='\0';
xuri=xi;up=r->unparsed_uri;
if (strcmp(up,xuri)==0){return DECLINED;} //no redirect for same URL
r->content_type = "text/html";
apr_table_set(r->headers_out,"Location",xuri);
return HTTP_MOVED_PERMANENTLY;
}else{
return HTTP_INTERNAL_SERVER_ERROR;
}
}
Currently the tail of any URL (for example, the /123 part from http://example.com/123) is read and only the tail is outputted, but I want the http://example.com/ part prepended.
What can I do to get strcat to work in my favor?
strcat doesn't update xuri. So xuri is still pointing to the beginning of the string after the two calls to strcat. So when the code reaches the statements *xuri=*up;xuri++;, it's overwriting the string starting from the beginning.
You can fix the problem by using sprintf instead, since that allows you to update xuri appropriately, e.g. replace these three lines
*xuri='\0';
strcat(xuri,"http://");
strcat(xuri,r->hostname);
with this line
xuri += sprintf( "http://%s", r->hostname );
Related
can anyone help me. I'm trying to create a folder, but when I use sprintf, it concatenates at the end special characters like OUUUU, how can I fix it?
there is an image (link below) where you can see the directory variable that has "/home/mia" and the buffer has "mkdir/home/miaOUUUU"
Any suggestions?
i'm using codeblocks in debian...
https://drive.google.com/file/d/1q3KKBbyDjA8_dfwKT54_OT_5QeREIz7k/view?usp=sharing
You should post the code in the body of the question, with copy+paste from your IDE and one extra indentation level (select the code and type Alt-K for that), not as a link to a bitmap, it is very rude.
directorio is not null terminated. You must declare it with one extra element as char directorio[i + 1]; and make sure to initialize directorio[i] to '\0'.
The memset is useless since you overwrite the whole buffer in the subsequent for loop. Do this instead:
char directorio[i + 1];
memcpy(directorio, path, i);
directorio[i] = '\0';
DIRP *dirp = opendir(directorio);
if (dirp == NULL) {
...
} else {
// do not forget to close the directory
closedir(dirp);
}
Also note that you should create directories from the root directory to the final path, and you should handle the spurious case of an existing file with the same name as one of the directories along the path.
We need to create a binary tree which contains content of textfiles. The pointer selection_a and selection_b pointing to another textfile in the directory.
The structure of the textfiles is following:
line: Title
line: OptionA
line: OptionB
line: Text.
The first file is given as parameter while starting the program. All files should be saved at the beginning of the program. Then the text of the first file shows, and the user can input A or B to continue. Based on the selection, the text of File Option A/B is shown and the user can decide again.
The last file of a tree contains no Options: lines 2 and 3 are "-\n".
The problem is, this code only reads all the option A files of the first tree. It doesn't read in any B-Options. In the end, the program shows a memory access error.
I think the problem is that the readingRows function has no abort condition.
current->selection_a = readingRows(input_selection_a);
current->selection_b = readingRows(input_selection_b);
I know the code may be kind of chaotic, but we are beginners in programming. Hope anybody can help us to write an abort-condition.
The function should be aborted if the content of option A (line 3) is "-\n".
Here is the whole function:
struct story_file* readingRows(FILE *current_file)
{
char *buffer = fileSize(current_file);
char *delimiter = "\n";
char *lines = strtok(buffer, delimiter);
int line_counter = 0;
struct story_file *current = malloc(sizeof(struct story_file));
while(lines != NULL)
{
if(line_counter == 0)
{
current->title = lines;
}
else if(line_counter == 1)
{
char *filename_chapter_a = lines;
FILE *input_selection_a = fopen(filename_chapter_a, "r");
if(input_selection_a)
{
current->selection_a = readingRows(input_selection_a);
}
fclose(input_selection_a);
}
else if(line_counter == 2)
{
char *filename_chapter_b = lines;
FILE *input_selection_b = fopen(filename_chapter_b, "r");
if(input_selection_b)
{
current->selection_b = readingRows(input_selection_b);
}
fclose(input_selection_b);
}
else if (line_counter >= 3)
{
current->text = lines;
}
lines = strtok(NULL, delimiter);
line_counter++;
}
return current;
}
There are two items that define a terminating recursive function:
One or more base cases
Recursive calls that move toward a base case
Your code has one base case: while (lines!=NULL) {} return current;, it breaks the while loop when lines is NULL and returns current. In other words, within any particular call to your function, it only terminates when it reaches the end of a file.
Your code moves toward that base case as long as your files do not refer to each other in a loop. We know this because you always read a line, take an action according to your if-else block, and the read the next line. So you always move toward the end of each file you read.
But as you note, the issue is that you don't have a case to handle "no Options", being when lines 2 or 3 are "-\n". So right now, even though you move through files, you are always opening files in line 2. Unless a file is malformed and does not contain a line 2, your recursive call tree never ends. So you just need to add another base case that looks at whether the beginning of lines matches "-\n", and if it does, return before the recursive call. This will end that branch of your recursive tree.
Inside of your while loop, you will need code along the lines of:
if `line_counter` is `2` or `3`
if `lines` starts with your terminating sequence "-\n"
return current
else
`fopen` and make the recursive call
In the parent function that made the recursive call, it will move to the next line and continue as expected.
P.S. Make sure you use free for each malloc you do.
I'm learning to use libcurl in C. To start, I'm using a randomized list of accession names to search for protein sequence files that may be found hosted here. These follow a set format where the first line is a variable length (but which contains no information I'm trying to query) then a series of capitalized letters with a new line every sixty (60) characters (what I want to pull down, but reformat to eighty (80) characters per line).
I have the call itself in a single function:
//finds and saves the fastas for each protein (assuming on exists)
void pullFasta (proteinEntry *entry, char matchType, FILE *outFile) {
//Local variables
URL_FILE *handle;
char buffer[2] = "", url[32] = "http://www.uniprot.org/uniprot/", sequence[2] = "";
//Build full URL
/*printf ("u:%s\nt:%s\n", url, entry->title); /*This line was used for debugging.*/
strcat (url, entry->title);
strcat (url, ".fasta");
//Open URL
/*printf ("u:%s\n", url); /*This line was used for debugging.*/
handle = url_fopen (url, "r");
//If there is data there
if (handle != NULL) {
//Skip the first line as it's got useless info
do {
url_fread(buffer, 1, 1, handle);
} while (buffer[0] != '\n');
//Grab the fasta data, skipping newline characters
while (!url_feof (handle)) {
url_fread(buffer, 1, 1, handle);
if (buffer[0] != '\n') {
strcat (sequence, buffer);
}
}
//Print it
printFastaEntry (entry->title, sequence, matchType, outFile);
}
url_fclose (handle);
return;
}
With proteinEntry being defined as:
//Entry for fasta formatable data
typedef struct proteinEntry {
char title[7];
struct proteinEntry *next;
} proteinEntry;
And the url_fopen, url_fclose, url_feof, url_read, and URL_FILE code found here, they mimic the file functions for which they are named.
As you can see I've been doing some debugging with the URL generator (uniprot URLs follow the same format for different proteins), I got it working properly and can pull down the data from the site and save it to file in the proper format that I want. I set the read buffer to 1 because I wanted to get a program that was very simplistic but functional (if inelegant) before I start playing with things, so I would have a base to return to as I learned.
I've tested the url_<function> calls and they are giving no errors. So I added incremental printf calls after each line to identify exactly where the bus error is occurring and it is happening at return;.
My understanding of bus errors is that it's a memory access issue wherein I'm trying to get at memory that my program doesn't have control over. My confusion comes from the fact that this is happening at the return of a void function. There's nothing being read, written, or passed to trigger the memory error (as far as I understand it, at least).
Can anyone point me in the right direction to fix my mistake please?
EDIT: As #BLUEPIXY pointed out I had a potential url_fclose (NULL). As #deltheil pointed out I had sequence as a static array. This also made me notice I'm repeating my bad memory allocation for url, so I updated it and it now works. Thanks for your help!
If we look at e.g http://www.uniprot.org/uniprot/Q6GZX1.fasta and skip the first line (as you do) we have:
MNAKYDTDQGVGRMLFLGTIGLAVVVGGLMAYGYYYDGKTPSSGTSFHTASPSFSSRYRY
Which is a 60 characters string.
When you try to read this sequence with:
//Grab the fasta data, skipping newline characters
while (!url_feof (handle)) {
url_fread(buffer, 1, 1, handle);
if (buffer[0] != '\n') {
strcat (sequence, buffer);
}
}
The problem is sequence is not expandable and not large enough (it is a fixed length array of size 2).
So make sure to choose a large enough size to hold any sequence, or implement the ability to expand it on-the-fly.
Goal:
Find if a string contains a blank line. Whether it be '\n\n',
'\r\n\r\n', '\r\n\n', '\n\r\n'
Issues:
I don't think my current regex for finding '\n\n' is right. This is my first time really using regex outside of simple use of * when removing files in command line.
Is it possible to check for all of these cases (listed above) in one regex? or do I have to do 4 seperate calls to compile_regex?
Code:
int checkForBlankLine(char *reader) {
regex_t r;
compile_regex(&r, "*\n\n");
match_regex(&r, reader);
return 0;
}
void compile_regex(regex_t *r, char *matchText) {
int status;
regcomp(r, matchText, 0);
}
int match_regex(regex_t *r, char *reader) {
regmatch_t match[1];
int nomatch = regexec(r, reader, 1, match, 0);
if (nomatch) {
printf("No matches.\n");
} else {
printf("MATCH!\n");
}
return 0;
}
Notes:
I only need to worry about finding one blank line, that's why my regmatch_t match[1] is only one item long
reader is the char array containing the text I am checking for a blank line.
I have seen other examples and tried to base the code off of those examples, but I still seem to be missing something.
Thank you kindly for the help/advice.
If anything needs to be clarified please let me know.
It seems that you have to compile the regex as extended:
regcomp(&re, "\r?\n\r?\n", REG_EXTENDED);
The first atom, \r? is probably unnecessary, because it doesn't add to the blank-line condition if you don't capture the result.
In the above, blank line really means empty line. If you want blank line to mean a line that has no characters except for white space, you can use:
regcomp(&re, "\r?\n[ \t]*\r?\n", REG_EXTENDED);
(I don't think you can use the space character pattern, \s here instead of [ \t], because that would include carriage return and new-line.)
As others have already hinted at, the "simple use of * in the command line` is not a regular expression. This wildcard-matching is called file globbing and has different semantics.
Check what the * in a regex means. It's not like the wildcard "anything" in the command line. The * means that the previous component can appear any amount of times. The wildcard in regex is the .. So if you want to say match anything you can do .*, which would be anything, any amount of times.
So in your case you can do .*\n\n.* which would match anything that has \n\n.
Finally, you can use or in a regex and ( ) to group stuff. So you can do something like .*(\n\n|\r\n\r\n).* And that would match anything that has a \n\n or a \r\n\r\n.
Hope that helps.
Rather than looking for only \r or \n, look for not \r or \n?
Your regex would simply be
'[^\r\n]'
and a match result of false indicates a blank line to your specification.
I found many examples of CreatingDirectory recursively, but not the one I was looking for.
here is the spec
Given input
\\server\share\aa\bb\cc
c:\aa\bb\cc
USING helper API
CreateDirectory (char * path)
returns true, if successful
else
FALSE
Condition: There should not be any parsing to distinguish if the path is Local or Server share.
Write a routine in C, or C++
I think it's quite easier... here a version that works in every Windows version:
unsigned int pos = 0;
do
{
pos = path.find_first_of("\\/", pos + 1);
CreateDirectory(path.substr(0, pos).c_str(), NULL);
} while (pos != std::string::npos);
Unicode:
pos = path.find_first_of(L"\\/", pos + 1);
Regards,
This might be exactly what you want.
It doesn't try to do any parsing to distinguish if the path is Local or Server share.
bool TryCreateDirectory(char *path){
char *p;
bool b;
if(
!(b=CreateDirectory(path))
&&
!(b=NULL==(p=strrchr(path, '\\')))
){
size_t i;
(p=strncpy((char *)malloc(1+i), path, i=p-path))[i]='\0';
b=TryCreateDirectory(p);
free(p);
b=b?CreateDirectory(path):false;
}
return b;
}
The algorithm is quite simple, just pass the string of higher level directory recursively while creation of current level of directory fails until one success or there is no more higher level. When the inner call returns with succeed, create the current. This method do not parse to determ the local or server it self, it's according to the CreateDirectory.
In WINAPI, CreateDirectory will never allows you to create "c:" or "\" when the path reaches that level, the method soon falls in to calling it self with path="" and this fails, too. It's the reason why Microsoft defines file sharing naming rule like this, for compatibility of DOS path rule and simplify the coding effort.
Totally hackish and insecure and nothing you'd ever actually want to do in production code, but...
Warning: here be code that was typed in a browser:
int createDirectory(const char * path) {
char * buffer = malloc((strlen(path) + 10) * sizeof(char));
sprintf(buffer, "mkdir -p %s", path);
int result = system(buffer);
free(buffer);
return result;
}
How about using MakeSureDirectoryPathExists() ?
Just walk through each directory level in the path starting from the root, attempting to create the next level.
If any of the CreateDirectory calls fail then you can exit early, you're successful if you get to the end of the path without a failure.
This is assuming that calling CreateDirectory on a path that already exists has no ill effects.
The requirement of not parsing the pathname for server names is interesting, as it seems to concede that parsing for / is required.
Perhaps the idea is to avoid building in hackish expressions for potentially complex syntax for hosts and mount points, which can have on some systems elaborate credentials encoded.
If it's homework, I may be giving away the algorithm you are supposed to think up, but it occurs to me that one way to meet those requirements is to start trying by attempting to mkdir the full pathname. If it fails, trim off the last directory and try again, if that fails, trim off another and try again... Eventually you should reach a root directory without needing to understand the server syntax, and then you will need to start adding pathname components back and making the subdirs one by one.
std::pair<bool, unsigned long> CreateDirectory(std::basic_string<_TCHAR> path)
{
_ASSERT(!path.empty());
typedef std::basic_string<_TCHAR> tstring;
tstring::size_type pos = 0;
while ((pos = path.find_first_of(_T("\\/"), pos + 1)) != tstring::npos)
{
::CreateDirectory(path.substr(0, pos + 1).c_str(), nullptr);
}
if ((pos = path.find_first_of(_T("\\/"), path.length() - 1)) == tstring::npos)
{
path.append(_T("\\"));
}
::CreateDirectory(path.c_str(), nullptr);
return std::make_pair(
::GetFileAttributes(path.c_str()) != INVALID_FILE_ATTRIBUTES,
::GetLastError()
);
}
void createFolders(const std::string &s, char delim) {
std::stringstream ss(s);
std::string item;
char combinedName[50]={'\0'};
while (std::getline(ss, item, delim)) {
sprintf(combinedName,"%s%s%c",combinedName,item.c_str(),delim);
cout<<combinedName<<endl;
struct stat st = {0};
if (stat(combinedName,&st)==-1)
{
#if REDHAT
mkdir(combinedName,0777);
#else
CreateDirectory(combinedName,NULL);
#endif
}
}
}